Details for d1c30e1

PDB Entry: 1c30 (more details), 2 Å

PDB Description: crystal structure of carbamoyl phosphate synthetase: small subunit mutation c269s

SCOP Domain Sequences for d1c30e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c30e1 a.92.1.1 (E:403-555) Carbamoyl phosphate synthetase, large subunit connection domain {Escherichia coli}
evgatgfdpkvslddpealtkirrelkdagadriwyiadafraglsvdgvfnltnidrwf
lvqieelvrleekvaevgitglnadflrqlkrkgfadarlaklagvreaeirklrdqydl
hpvykrvdtcaaefatdtaymystyeeeceanp

SCOP Domain Coordinates for d1c30e1:

Click to download the PDB-style file with coordinates for d1c30e1.
(The format of our PDB-style files is described here.)

Timeline for d1c30e1: