SCOPe 2.06: Domain d3stgb_: 3stg B:

Lineage for d3stgb_ (3stg B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.10: Aldolase [51569] (9 families)
   Common fold covers whole protein structure

5. Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins)

6. Protein automated matches [190083] (9 species)
   not a true protein

7. Species Neisseria meningitidis [TaxId:122586] [189819] (16 PDB entries)

8. Domain d3stgb_: 3stg B: [185558]
   automated match to d1d9ea_
   complexed with cl; mutant

Details for d3stgb_

PDB Entry: 3stg, 2.2 Å

PDB Description: Crystal structure of A58P, DEL(N59), and loop 7 truncated mutant of 3-deoxy-D-manno-octulosonate 8-phosphate synthase (KDO8PS) from Neisseria meningitidis

PDB Compounds: (B:) 2-dehydro-3-deoxyphosphooctonate aldolase

SCOPe Domain Sequences for d3stgb_:

Sequence; same for both SEQRES and ATOM records:

>d3stgb_ c.1.10.4 (B:) automated matches {Neisseria meningitidis [TaxId: 122586]}
mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkprs
sihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtdl
vvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlgf
gvmkqtcgnlpvifdvthslgrraqaldlalagmatrlaglfleshpdpklakcdgpsal
plhlledflirikalddliksqpiltie

Timeline for d3stgb_:

• d3stgb_ first appeared in SCOPe 2.01
  
• d3stgb_ appears in SCOPe 2.05
  
• d3stgb_ appears in SCOPe 2.07
  
• d3stgb_ appears in the current release, SCOPe 2.08