Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.4: Class I DAHP synthetase [51599] (3 proteins) |
Protein automated matches [190083] (9 species) not a true protein |
Species Neisseria meningitidis [TaxId:122586] [189819] (16 PDB entries) |
Domain d3stgb_: 3stg B: [185558] automated match to d1d9ea_ complexed with cl; mutant |
PDB Entry: 3stg (more details), 2.2 Å
SCOPe Domain Sequences for d3stgb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3stgb_ c.1.10.4 (B:) automated matches {Neisseria meningitidis [TaxId: 122586]} mdikinditlgnnspfvlfgginvlesldstlqtcahyvevtrklgipyifkasfdkprs sihsyrgvgleeglkifekvkaefgipvitdvhephqcqpvaevcdviqlpaflarqtdl vvamaktgnvvnikkpqflspsqmknivekfheagngklilcergssfgydnlvvdmlgf gvmkqtcgnlpvifdvthslgrraqaldlalagmatrlaglfleshpdpklakcdgpsal plhlledflirikalddliksqpiltie
Timeline for d3stgb_: