Lineage for d3stal_ (3sta L:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2099098Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2099099Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2099100Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 protein domains)
    automatically mapped to Pfam PF00574
  6. 2099101Protein Clp protease, ClpP subunit [52098] (9 species)
  7. 2099230Species Staphylococcus aureus [TaxId:196620] [189881] (4 PDB entries)
  8. 2099239Domain d3stal_: 3sta L: [185539]
    automated match to d1tyfa_

Details for d3stal_

PDB Entry: 3sta (more details), 2.28 Å

PDB Description: Crystal structure of ClpP in tetradecameric form from Staphylococcus aureus
PDB Compounds: (L:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3stal_:

Sequence, based on SEQRES records: (download)

>d3stal_ c.14.1.1 (L:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]}
iptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyly
inspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmih
qplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakey
glidevmvp

Sequence, based on observed residues (ATOM records): (download)

>d3stal_ c.14.1.1 (L:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]}
iptvietraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylyinspg
gsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplgg
aqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglide
vmvp

SCOPe Domain Coordinates for d3stal_:

Click to download the PDB-style file with coordinates for d3stal_.
(The format of our PDB-style files is described here.)

Timeline for d3stal_: