Lineage for d3stai_ (3sta I:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 980706Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 980707Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 980708Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
  6. 980709Protein Clp protease, ClpP subunit [52098] (8 species)
  7. 980823Species Staphylococcus aureus [TaxId:196620] [189881] (2 PDB entries)
  8. 980830Domain d3stai_: 3sta I: [185537]
    automated match to d1tyfa_

Details for d3stai_

PDB Entry: 3sta (more details), 2.28 Å

PDB Description: Crystal structure of ClpP in tetradecameric form from Staphylococcus aureus
PDB Compounds: (I:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d3stai_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3stai_ c.14.1.1 (I:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]}
iptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyly
inspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmih
qplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakey
glidevmvp

SCOPe Domain Coordinates for d3stai_:

Click to download the PDB-style file with coordinates for d3stai_.
(The format of our PDB-style files is described here.)

Timeline for d3stai_: