| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) ![]() |
| Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins) automatically mapped to Pfam PF00574 |
| Protein Clp protease, ClpP subunit [52098] (11 species) |
| Species Staphylococcus aureus [TaxId:196620] [189881] (4 PDB entries) |
| Domain d3staa_: 3sta A: [185531] automated match to d1tyfa_ |
PDB Entry: 3sta (more details), 2.28 Å
SCOPe Domain Sequences for d3staa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3staa_ c.14.1.1 (A:) Clp protease, ClpP subunit {Staphylococcus aureus [TaxId: 196620]}
iptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyly
inspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmih
qplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakey
glidevmvp
Timeline for d3staa_: