SCOPe 2.07: Domain d3st4b1: 3st4 B:3-231

Lineage for d3st4b1 (3st4 B:3-231)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (22 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (63 PDB entries)

8. Domain d3st4b1: 3st4 B:3-231 [185520]
   Other proteins in same PDB: d3st4a2, d3st4b2
   automated match to d1huya_
   complexed with po4

Details for d3st4b1

PDB Entry: 3st4, 2 Å

PDB Description: dreiklang - on state

PDB Compounds: (B:) Dreiklang

SCOPe Domain Sequences for d3st4b1:

Sequence; same for both SEQRES and ATOM records:

>d3st4b1 d.22.1.1 (B:3-231) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptllt
tigyglmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynhdshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitl

Timeline for d3st4b1:

• d3st4b1 first appeared in SCOPe 2.01, called d3st4b_
  
• d3st4b1 was called d3st4b_ in SCOPe 2.06
  
• d3st4b1 appears in the current release, SCOPe 2.08