Lineage for d3st4b_ (3st4 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1021948Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 1021949Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 1021950Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 1022143Protein automated matches [190406] (14 species)
    not a true protein
  7. 1022257Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (27 PDB entries)
  8. 1022292Domain d3st4b_: 3st4 B: [185520]
    automated match to d1huya_
    complexed with po4

Details for d3st4b_

PDB Entry: 3st4 (more details), 2 Å

PDB Description: dreiklang - on state
PDB Compounds: (B:) Dreiklang

SCOPe Domain Sequences for d3st4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3st4b_ d.22.1.1 (B:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptllt
tigyglmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnr
ielkgidfkedgnilghkleynhdshnvyimadkqkngikvnfkirhniedgsvqladhy
qqntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitlgmdelyk

SCOPe Domain Coordinates for d3st4b_:

Click to download the PDB-style file with coordinates for d3st4b_.
(The format of our PDB-style files is described here.)

Timeline for d3st4b_: