SCOPe 2.01: Domain d3st3c_: 3st3 C:

Lineage for d3st3c_ (3st3 C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (14 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (27 PDB entries)

8. Domain d3st3c_: 3st3 C: [185518]
   automated match to d1huya_
   complexed with po4

Details for d3st3c_

PDB Entry: 3st3, 1.7 Å

PDB Description: dreiklang - off state

PDB Compounds: (C:) Dreiklang

SCOPe Domain Sequences for d3st3c_:

Sequence; same for both SEQRES and ATOM records:

>d3st3c_ d.22.1.1 (C:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptllt
tixlmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie
lkgidfkedgnilghkleynhdshnvyimadkqkngikvnfkirhniedgsvqladhyqq
ntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitlgmd

Timeline for d3st3c_:

• d3st3c_ is new in SCOPe 2.01-stable
  
• d3st3c_ appears in SCOPe 2.02
  
• d3st3c_ appears in the current release, SCOPe 2.08, called d3st3c1