Lineage for d3st3c1 (3st3 C:3-231)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939772Fold d.22: GFP-like [54510] (1 superfamily)
    beta-sheet folds into a barrel (n=11, S=14) around the central helix
  4. 2939773Superfamily d.22.1: GFP-like [54511] (3 families) (S)
  5. 2939774Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)
  6. 2940226Protein automated matches [190406] (19 species)
    not a true protein
  7. 2940415Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (58 PDB entries)
  8. 2940459Domain d3st3c1: 3st3 C:3-231 [185518]
    Other proteins in same PDB: d3st3a2, d3st3b2, d3st3c2
    automated match to d1huya_
    complexed with po4

Details for d3st3c1

PDB Entry: 3st3 (more details), 1.7 Å

PDB Description: dreiklang - off state
PDB Compounds: (C:) Dreiklang

SCOPe Domain Sequences for d3st3c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3st3c1 d.22.1.1 (C:3-231) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptllt
tixlmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie
lkgidfkedgnilghkleynhdshnvyimadkqkngikvnfkirhniedgsvqladhyqq
ntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitl

SCOPe Domain Coordinates for d3st3c1:

Click to download the PDB-style file with coordinates for d3st3c1.
(The format of our PDB-style files is described here.)

Timeline for d3st3c1: