Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) |
Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
Protein automated matches [190406] (19 species) not a true protein |
Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (58 PDB entries) |
Domain d3st3b1: 3st3 B:3-231 [185517] Other proteins in same PDB: d3st3a2, d3st3b2, d3st3c2 automated match to d1huya_ complexed with po4 |
PDB Entry: 3st3 (more details), 1.7 Å
SCOPe Domain Sequences for d3st3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3st3b1 d.22.1.1 (B:3-231) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]} kgeelftgvvpilveldgdvnghkfsvsgegegdatygkltlkficttgklpvpwptllt tixlmcfarypdhmkqhdffksampegyvqertiffkddgnyktraevkfegdtlvnrie lkgidfkedgnilghkleynhdshnvyimadkqkngikvnfkirhniedgsvqladhyqq ntpigdgpvllpdnhylsyqsalskdpnekrdhmvllefvtaagitl
Timeline for d3st3b1:
View in 3D Domains from other chains: (mouse over for more information) d3st3a1, d3st3a2, d3st3c1, d3st3c2 |