SCOPe 2.08: Domain d3sswn_: 3ssw N:

Lineage for d3sswn_ (3ssw N:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.12: TrpR-like [48295] (4 families)
   contains an extra shared helix after the HTH motif

5. Family a.4.12.1: Trp repressor, TrpR [48296] (2 proteins)
   intertwined dimer of identical 6-helical subunits
   automatically mapped to Pfam PF01371

6. Protein Trp repressor, TrpR [48297] (1 species)

7. Species Escherichia coli [TaxId:562] [48298] (19 PDB entries)

8. Domain d3sswn_: 3ssw N: [185509]
   automated match to d1co0a_

Details for d3sswn_

PDB Entry: 3ssw, 1.67 Å

PDB Description: E. coli trp aporepressor

PDB Compounds: (N:) trp operon repressor

SCOPe Domain Sequences for d3sswn_:

Sequence; same for both SEQRES and ATOM records:

>d3sswn_ a.4.12.1 (N:) Trp repressor, TrpR {Escherichia coli [TaxId: 562]}
saamaeqrhqewlrfvdllknayqndlhlpllnlmltpderealgtrvriveellrgems
qrelknelgagiatitrgsnslkaapvelrqwleevll

Timeline for d3sswn_:

• d3sswn_ first appeared in SCOPe 2.01
  
• d3sswn_ appears in SCOPe 2.07