Lineage for d3ss1a_ (3ss1 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133953Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2133954Protein automated matches [190951] (26 species)
    not a true protein
  7. 2133985Species Clostridium difficile [TaxId:272563] [189893] (2 PDB entries)
  8. 2133986Domain d3ss1a_: 3ss1 A: [185506]
    automated match to d2vkda1
    complexed with mn

Details for d3ss1a_

PDB Entry: 3ss1 (more details), 2.2 Å

PDB Description: Clostridium difficile toxin A (TcdA) glucolsyltransferase domain
PDB Compounds: (A:) Toxin A

SCOPe Domain Sequences for d3ss1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ss1a_ c.68.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}
sliskeeliklaysirpreneyktiltnldeynklttnnnenkylqlkklnesidvfmnk
yktssrnralsnlkkdilkeviliknsntspveknlhfvwiggevsdialeyikqwadin
aeyniklwydseaflvntlkkaivessttealqlleeeiqnpqfdnmkfykkrmefiydr
qkrfinyyksqinkptvptiddiikshlvseynrdetvlesyrtnslrkinsnhgidira
nslfteqellniysqellnrgnlaaasdivrllalknfggvyldvdmlpgihsdlfktis
rpssigldrwemikleaimkykkyinnytsenfdkldqqlkdnfkliiesksekseifsk
lenlnvsdleikiafalgsvinqaliskqgsyltnlvieqvknryqflnqhlnpaiesdn
nftdttkifhdslfnsataensmfltkiapylqvgfmpearstislsgpgayasayydfi
nlqentiektlkasdliefkfpennlsqlteqeinslwsfdqasakyqfekyvrdyt

SCOPe Domain Coordinates for d3ss1a_:

Click to download the PDB-style file with coordinates for d3ss1a_.
(The format of our PDB-style files is described here.)

Timeline for d3ss1a_: