Lineage for d3sr4a_ (3sr4 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893876Family c.66.1.31: Catalytic, N-terminal domain of histone methyltransferase Dot1l [89746] (2 proteins)
  6. 2893884Protein automated matches [191247] (1 species)
    not a true protein
  7. 2893885Species Human (Homo sapiens) [TaxId:9606] [189737] (31 PDB entries)
  8. 2893890Domain d3sr4a_: 3sr4 A: [185495]
    automated match to d1nw3a_
    complexed with act, gol, so4, tt8

Details for d3sr4a_

PDB Entry: 3sr4 (more details), 2.5 Å

PDB Description: Crystal Structure of Human DOT1L in Complex with a Selective Inhibitor
PDB Compounds: (A:) Histone-lysine N-methyltransferase, H3 lysine-79 specific

SCOPe Domain Sequences for d3sr4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sr4a_ c.66.1.31 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyvlidyd
tksfesmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsvtdpek
lnnyepfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhyg
vekadipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnfa
fgpevdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkgsvs
wtgkpvsyylhtidrtilenyfsslknp

SCOPe Domain Coordinates for d3sr4a_:

Click to download the PDB-style file with coordinates for d3sr4a_.
(The format of our PDB-style files is described here.)

Timeline for d3sr4a_: