![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.31: Catalytic, N-terminal domain of histone methyltransferase Dot1l [89746] (2 proteins) |
![]() | Protein automated matches [191247] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189737] (31 PDB entries) |
![]() | Domain d3sr4a_: 3sr4 A: [185495] automated match to d1nw3a_ complexed with act, gol, so4, tt8 |
PDB Entry: 3sr4 (more details), 2.5 Å
SCOPe Domain Sequences for d3sr4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sr4a_ c.66.1.31 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lelrlkspvgaepavypwplpvydkhhdaaheiietirwvceeipdlklamenyvlidyd tksfesmqrlcdkynraidsihqlwkgttqpmklntrpstgllrhilqqvynhsvtdpek lnnyepfspevygetsfdlvaqmideikmtdddlfvdlgsgvgqvvlqvaaatnckhhyg vekadipakyaetmdrefrkwmkwygkkhaeytlergdflseewreriantsvifvnnfa fgpevdhqlkerfanmkeggrivsskpfaplnfrinsrnlsdigtimrvvelsplkgsvs wtgkpvsyylhtidrtilenyfsslknp
Timeline for d3sr4a_: