Class b: All beta proteins [48724] (174 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein automated matches [190044] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187233] (110 PDB entries) |
Domain d3sqhe_: 3sqh E: [185491] automated match to d1doja_ mutant |
PDB Entry: 3sqh (more details), 2.2 Å
SCOPe Domain Sequences for d3sqhe_:
Sequence, based on SEQRES records: (download)
>d3sqhe_ b.47.1.2 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcg aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt anvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdaggpf vmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
>d3sqhe_ b.47.1.2 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]} eadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcg aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt apsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdaggpfvmkspf nnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
Timeline for d3sqhe_: