Lineage for d3sqhe_ (3sqh E:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2057491Protein automated matches [190044] (14 species)
    not a true protein
  7. 2057530Species Human (Homo sapiens) [TaxId:9606] [187233] (146 PDB entries)
  8. 2057629Domain d3sqhe_: 3sqh E: [185491]
    automated match to d1doja_
    mutant

Details for d3sqhe_

PDB Entry: 3sqh (more details), 2.2 Å

PDB Description: Crystal structure of prethrombin-2 mutant S195A in the the open form
PDB Compounds: (E:) Thrombin light chain, heavy chain

SCOPe Domain Sequences for d3sqhe_:

Sequence, based on SEQRES records: (download)

>d3sqhe_ b.47.1.2 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt
anvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdaggpf
vmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Sequence, based on observed residues (ATOM records): (download)

>d3sqhe_ b.47.1.2 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt
apsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdaggpfvmkspf
nnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOPe Domain Coordinates for d3sqhe_:

Click to download the PDB-style file with coordinates for d3sqhe_.
(The format of our PDB-style files is described here.)

Timeline for d3sqhe_: