Lineage for d3sqfa_ (3sqf A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2391025Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2391026Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2391027Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2392314Protein automated matches [190433] (11 species)
    not a true protein
  7. 2392459Species Mason-pfizer monkey virus [TaxId:11855] [189736] (1 PDB entry)
  8. 2392460Domain d3sqfa_: 3sqf A: [185489]
    automated match to d1nsoa_

Details for d3sqfa_

PDB Entry: 3sqf (more details), 1.63 Å

PDB Description: Crystal structure of monomeric M-PMV retroviral protease
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3sqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sqfa_ b.50.1.1 (A:) automated matches {Mason-pfizer monkey virus [TaxId: 11855]}
kpsltlwlddkmftglintgadvtiikledwppnwpitdtltnlrgigqsnnpkqsskyl
twrdkennsglikpfvipnlpvnlwgrdllsqmki

SCOPe Domain Coordinates for d3sqfa_:

Click to download the PDB-style file with coordinates for d3sqfa_.
(The format of our PDB-style files is described here.)

Timeline for d3sqfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3sqfb_