Lineage for d3sqee_ (3sqe E:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405313Protein Thrombin [50531] (2 species)
  7. 2405349Species Human (Homo sapiens) [TaxId:9606] [50532] (171 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 2405372Domain d3sqee_: 3sqe E: [185488]
    automated match to d1doja_
    complexed with gol; mutant

Details for d3sqee_

PDB Entry: 3sqe (more details), 1.9 Å

PDB Description: Crystal structure of prethrombin-2 mutant S195A in the alternative form
PDB Compounds: (E:) Thrombin light chain, heavy chain

SCOPe Domain Sequences for d3sqee_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sqee_ b.47.1.2 (E:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
eadcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt
anvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdaggpf
vmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg

SCOPe Domain Coordinates for d3sqee_:

Click to download the PDB-style file with coordinates for d3sqee_.
(The format of our PDB-style files is described here.)

Timeline for d3sqee_: