Lineage for d3sq6e_ (3sq6 E:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810672Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 1810673Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 1810674Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 1810768Protein automated matches [190922] (3 species)
    not a true protein
  7. 1810992Species Human (Homo sapiens) [TaxId:9606] [189722] (2 PDB entries)
  8. 1810997Domain d3sq6e_: 3sq6 E: [185482]
    automated match to d1uw6a_
    complexed with epj, nag

Details for d3sq6e_

PDB Entry: 3sq6 (more details), 2.8 Å

PDB Description: crystal structures of the ligand binding domain of a pentameric alpha7 nicotinic receptor chimera with its agonist epibatidine
PDB Compounds: (E:) Neuronal acetylcholine receptor subunit alpha-7, Acetylcholine-binding protein

SCOPe Domain Sequences for d3sq6e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sq6e_ b.96.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtdhy
lqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsirqr
fscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrser
fyecckepypdvtftvtfrkkg

SCOPe Domain Coordinates for d3sq6e_:

Click to download the PDB-style file with coordinates for d3sq6e_.
(The format of our PDB-style files is described here.)

Timeline for d3sq6e_: