Class b: All beta proteins [48724] (176 folds) |
Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds |
Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) |
Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins) automatically mapped to Pfam PF02931 |
Protein automated matches [190922] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189722] (2 PDB entries) |
Domain d3sq6d_: 3sq6 D: [185481] automated match to d1uw6a_ complexed with epj, nag |
PDB Entry: 3sq6 (more details), 2.8 Å
SCOPe Domain Sequences for d3sq6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sq6d_ b.96.1.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} efqrklykelvknynpdviptqrdrpvtvyfslsllqimdvdeknqvvdvvfwlqmswtd hylqwnvseypgvkqvsvpisslwvpdlaaynaiskpevltpqlalvnssghvqylpsir qrfscdvsgvdtesgatcklkfgswthhsreldlqmqeadisgyipysrfelvgvtqkrs erfyecckepypdvtftvtfrkkg
Timeline for d3sq6d_: