Lineage for d1dk8a_ (1dk8 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2328088Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2328089Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2328090Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 protein domains)
  6. 2328091Protein Axin RGS-homologous domain [48105] (1 species)
  7. 2328092Species Human (Homo sapiens) [TaxId:9606] [48106] (2 PDB entries)
  8. 2328093Domain d1dk8a_: 1dk8 A: [18548]
    complexed with dtt, gol, so4

Details for d1dk8a_

PDB Entry: 1dk8 (more details), 1.57 Å

PDB Description: crystal structure of the rgs-homologous domain of axin
PDB Compounds: (A:) Axin

SCOPe Domain Sequences for d1dk8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dk8a_ a.91.1.1 (A:) Axin RGS-homologous domain {Human (Homo sapiens) [TaxId: 9606]}
gsasptppylkwaeslhsllddqdgislfrtflkqegcadlldfwfactgfrklepcdsn
eekrlklaraiyrkyildnngivsrqtkpatksfikgcimkqlidpamfdqaqteiqatm
eentypsflksdiyleytrtgsespkv

SCOPe Domain Coordinates for d1dk8a_:

Click to download the PDB-style file with coordinates for d1dk8a_.
(The format of our PDB-style files is described here.)

Timeline for d1dk8a_: