SCOPe 2.08: Domain d3soib_: 3soi B:

Lineage for d3soib_ (3soi B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Bacillus licheniformis [TaxId:1402] [188244] (18 PDB entries)

8. Domain d3soib_: 3soi B: [185473]
   automated match to d2blma_
   complexed with cit

Details for d3soib_

PDB Entry: 3soi, 1.73 Å

PDB Description: Crystallographic structure of Bacillus licheniformis beta-lactamase W210F/W229F/W251F at 1.73 angstrom resolution

PDB Compounds: (B:) Beta-lactamase

SCOPe Domain Sequences for d3soib_:

Sequence; same for both SEQRES and ATOM records:

>d3soib_ e.3.1.1 (B:) automated matches {Bacillus licheniformis [TaxId: 1402]}
ddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedlnq
ritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkkelr
kigdevtnperfepelnevnpgetqdtstaralvtslrafaledklpsekrellidfmkr
nttgdaliragvpdgfevadktgaasygtrndiaiifppkgdpvvlavlssrdkkdakyd
dkliaeatkvvmkaln

Timeline for d3soib_:

• d3soib_ first appeared in SCOPe 2.01
  
• d3soib_ appears in SCOPe 2.07