SCOPe 2.08: Domain d3soga_: 3sog A:

Lineage for d3soga_ (3sog A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.238: BAR/IMD domain-like [116747] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families)
   core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends

5. Family a.238.1.0: automated matches [191660] (1 protein)
   not a true family

6. Protein automated matches [191240] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189695] (6 PDB entries)

8. Domain d3soga_: 3sog A: [185471]
   automated match to d1urua_
   complexed with edo, k

Details for d3soga_

PDB Entry: 3sog, 2.3 Å

PDB Description: crystal structure of the bar domain of human amphiphysin, isoform 1

PDB Compounds: (A:) amphiphysin

SCOPe Domain Sequences for d3soga_:

Sequence, based on SEQRES records:

>d3soga_ a.238.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deqfeeyvqnfkrqeaegtrlqrelrgylaaikgmqeasmklteslhevyepdwygredv
kmvgekcdvlwedfhqklvdgslltldtylgqfpdiknriakrsrklvdydsarhhleal
qsskrkdesriskaeeefqkaqkvfeefnvdlqeelpslwsrrvgfyvntfknvssleak
fhkeiavlchklyevmtklg

Sequence, based on observed residues (ATOM records):

>d3soga_ a.238.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
deqfeeyvqnfkrqeaegtrlqrelrgylaaikgmqeasmklteslhevyepdwygredv
kmvgekcdvlwedfhqklvdgslltldtylgqfpdiknriakrsrklvdydsarhhleal
qskdesriskaeeefqkaqkvfeefnvdlqeelpslwsrrvgfyvntfknvssleakfhk
eiavlchklyevmtklg

Timeline for d3soga_:

• d3soga_ first appeared in SCOPe 2.01
  
• d3soga_ appears in SCOPe 2.07