Lineage for d1cmza_ (1cmz A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004960Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2004961Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2004962Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 2004978Protein Galpha interacting protein, GaIP [48103] (1 species)
  7. 2004979Species Human (Homo sapiens) [TaxId:9606] [48104] (1 PDB entry)
  8. 2004980Domain d1cmza_: 1cmz A: [18547]

Details for d1cmza_

PDB Entry: 1cmz (more details)

PDB Description: solution structure of gaip (galpha interacting protein): a regulator of g protein signaling
PDB Compounds: (A:) protein (gaip (g-alpha interacting) protein)

SCOPe Domain Sequences for d1cmza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmza_ a.91.1.1 (A:) Galpha interacting protein, GaIP {Human (Homo sapiens) [TaxId: 9606]}
pspeevqswaqsfdklmhspagrsvfraflrteyseenmlfwlaceelkaeanqhvvdek
arliyedyvsilspkevsldsrvreginkkmqepsahtfddaqlqiytlmhrdsyprfls
sptyrall

SCOPe Domain Coordinates for d1cmza_:

Click to download the PDB-style file with coordinates for d1cmza_.
(The format of our PDB-style files is described here.)

Timeline for d1cmza_: