Lineage for d1cmza_ (1cmz A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215831Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 215832Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) (S)
  5. 215833Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (6 proteins)
  6. 215838Protein Galpha interacting protein, GaIP [48103] (1 species)
  7. 215839Species Human (Homo sapiens) [TaxId:9606] [48104] (1 PDB entry)
  8. 215840Domain d1cmza_: 1cmz A: [18547]

Details for d1cmza_

PDB Entry: 1cmz (more details)

PDB Description: solution structure of gaip (galpha interacting protein): a regulator of g protein signaling

SCOP Domain Sequences for d1cmza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmza_ a.91.1.1 (A:) Galpha interacting protein, GaIP {Human (Homo sapiens)}
pspeevqswaqsfdklmhspagrsvfraflrteyseenmlfwlaceelkaeanqhvvdek
arliyedyvsilspkevsldsrvreginkkmqepsahtfddaqlqiytlmhrdsyprfls
sptyrall

SCOP Domain Coordinates for d1cmza_:

Click to download the PDB-style file with coordinates for d1cmza_.
(The format of our PDB-style files is described here.)

Timeline for d1cmza_: