![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
![]() | Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
![]() | Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
![]() | Protein automated matches [191109] (11 species) not a true protein |
![]() | Species Clostridium beijerinckii [TaxId:290402] [189152] (7 PDB entries) |
![]() | Domain d3so1g_: 3so1 G: [185466] automated match to d1npsa_ complexed with ca, so4; mutant |
PDB Entry: 3so1 (more details), 1.85 Å
SCOPe Domain Sequences for d3so1g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3so1g_ b.11.1.0 (G:) automated matches {Clostridium beijerinckii [TaxId: 290402]} tkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftg tkwtytsdtpwvgndandkmssvkiyst
Timeline for d3so1g_: