SCOP 1.67: Domain d1fqkd_: 1fqk D:

Lineage for d1fqkd_ (1fqk D:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (1 family)

5. Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (7 proteins)

6. Protein RGS9, RGS domain [48101] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48102] (3 PDB entries)

8. Domain d1fqkd_: 1fqk D: [18546]
   Other proteins in same PDB: d1fqka1, d1fqka2, d1fqkc1, d1fqkc2
   complexed with alf, gdp, mg

Details for d1fqkd_

PDB Entry: 1fqk, 2.3 Å

PDB Description: crystal structure of the heterodimeric complex of the rgs domain of rgs9, and the gt/i1 chimera alpha subunit [(rgs9)-(gt/i1alpha)-(gdp)- (alf4-)-(mg2+)]

SCOP Domain Sequences for d1fqkd_:

Sequence; same for both SEQRES and ATOM records:

>d1fqkd_ a.91.1.1 (D:) RGS9, RGS domain {Cow (Bos taurus)}
fwdlnaklvdiptkmrverwafnfselirdpkgrqsfqhflrkefsgenlgfweacedlk
ygdqskvkekaeeiyklflapgarrwinidgktmditvkglkhphryvldaaqthiymlm
kkdsyarylkspiykemlakaie

Timeline for d1fqkd_:

• d1fqkd_ first appeared (with stable ids) in SCOP 1.55
  
• d1fqkd_ appears in SCOP 1.65
  
• d1fqkd_ appears in SCOP 1.69
  
• d1fqkd_ appears in the current release, SCOPe 2.08