Lineage for d3so0h_ (3so0 H:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045692Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2045693Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2045820Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2045821Protein automated matches [191109] (11 species)
    not a true protein
  7. 2045825Species Clostridium beijerinckii [TaxId:290402] [189152] (7 PDB entries)
  8. 2045842Domain d3so0h_: 3so0 H: [185459]
    automated match to d1npsa_
    complexed with ca; mutant

Details for d3so0h_

PDB Entry: 3so0 (more details), 1.93 Å

PDB Description: Crystal structure of a mutant T41S of a betagamma-crystallin domain from Clostridium beijerinckii
PDB Compounds: (H:) Clostrillin

SCOPe Domain Sequences for d3so0h_:

Sequence, based on SEQRES records: (download)

>d3so0h_ b.11.1.0 (H:) automated matches {Clostridium beijerinckii [TaxId: 290402]}
avtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftgtk
wtytsdtpwvgndandkmtsvkiys

Sequence, based on observed residues (ATOM records): (download)

>d3so0h_ b.11.1.0 (H:) automated matches {Clostridium beijerinckii [TaxId: 290402]}
avtfyedinyggasvslqpgnytlsqlndwmsslkvpsgwtvdvyendnftgtkwtytsd
tpwvmtsvkiys

SCOPe Domain Coordinates for d3so0h_:

Click to download the PDB-style file with coordinates for d3so0h_.
(The format of our PDB-style files is described here.)

Timeline for d3so0h_: