| Class b: All beta proteins [48724] (180 folds) |
| Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) ![]() |
| Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
| Protein automated matches [191109] (11 species) not a true protein |
| Species Clostridium beijerinckii [TaxId:290402] [189152] (7 PDB entries) |
| Domain d3so0e_: 3so0 E: [185456] automated match to d1npsa_ complexed with ca; mutant |
PDB Entry: 3so0 (more details), 1.93 Å
SCOPe Domain Sequences for d3so0e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3so0e_ b.11.1.0 (E:) automated matches {Clostridium beijerinckii [TaxId: 290402]}
kavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftgt
kwtytsdtpwvgndandkmtsvkiys
Timeline for d3so0e_: