Lineage for d3so0b_ (3so0 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776437Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 1776438Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 1776560Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 1776561Protein automated matches [191109] (10 species)
    not a true protein
  7. 1776568Species Clostridium beijerinckii [TaxId:290402] [189152] (6 PDB entries)
  8. 1776579Domain d3so0b_: 3so0 B: [185453]
    automated match to d1npsa_
    complexed with ca; mutant

Details for d3so0b_

PDB Entry: 3so0 (more details), 1.93 Å

PDB Description: Crystal structure of a mutant T41S of a betagamma-crystallin domain from Clostridium beijerinckii
PDB Compounds: (B:) Clostrillin

SCOPe Domain Sequences for d3so0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3so0b_ b.11.1.0 (B:) automated matches {Clostridium beijerinckii [TaxId: 290402]}
tkavtfyedinyggasvslqpgnytlsqlntakipndwmsslkvpsgwtvdvyendnftg
tkwtytsdtpwvgndandkmtsvkiys

SCOPe Domain Coordinates for d3so0b_:

Click to download the PDB-style file with coordinates for d3so0b_.
(The format of our PDB-style files is described here.)

Timeline for d3so0b_: