Lineage for d3snfa_ (3snf A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1192691Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1192692Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1192693Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1192694Protein Amphibian cytotoxic ribonuclease [54084] (5 species)
  7. 1192708Species Frog (Rana pipiens), P-30 [TaxId:8404] [54083] (10 PDB entries)
  8. 1192709Domain d3snfa_: 3snf A: [185449]
    automated match to d1onca_
    complexed with act, so4

Details for d3snfa_

PDB Entry: 3snf (more details), 1.1 Å

PDB Description: onconase, atomic resolution crystal structure
PDB Compounds: (A:) Protein P-30

SCOPe Domain Sequences for d3snfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3snfa_ d.5.1.1 (A:) Amphibian cytotoxic ribonuclease {Frog (Rana pipiens), P-30 [TaxId: 8404]}
edwltfqkkhitntrdvdcdnimstnlfhckdkntfiysrpepvkaickgiiasknvltt
sefylsdcnvtsrpckyklkkstnkfcvtcenqapvhfvgvgsc

SCOPe Domain Coordinates for d3snfa_:

Click to download the PDB-style file with coordinates for d3snfa_.
(The format of our PDB-style files is described here.)

Timeline for d3snfa_: