SCOPe 2.05: Domain d3snca_: 3snc A:

Lineage for d3snca_ (3snc A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (4 proteins)

6. Protein Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) [74979] (6 species)
   contains an extra alpha-helical domain

7. Species SARS coronavirus [TaxId:227859] [89349] (65 PDB entries)

8. Domain d3snca_: 3snc A: [185445]
   automated match to d1uj1b_
   complexed with dms

Details for d3snca_

PDB Entry: 3snc, 2.58 Å

PDB Description: Crystal structure of SARS coronavirus main protease complexed with Ac-NSTSQ-H (soaking)

PDB Compounds: (A:) 3C-like proteinase

SCOPe Domain Sequences for d3snca_:

Sequence; same for both SEQRES and ATOM records:

>d3snca_ b.47.1.4 (A:) Coronavirus main proteinase (3Cl-pro, putative coronavirus nsp2) {SARS coronavirus [TaxId: 227859]}
sgfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllir
ksnhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyng
spsgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegk
fygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynye
pltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqc
sgvtfq

Timeline for d3snca_:

• d3snca_ first appeared in SCOPe 2.01
  
• d3snca_ appears in SCOPe 2.04
  
• d3snca_ appears in SCOPe 2.06
  
• d3snca_ appears in the current release, SCOPe 2.08