Lineage for d3slpb_ (3slp B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2882263Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2882264Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2882446Family c.52.1.13: lambda exonuclease [53017] (1 protein)
  6. 2882447Protein lambda exonuclease [53018] (1 species)
  7. 2882448Species Bacteriophage lambda [TaxId:10710] [53019] (4 PDB entries)
  8. 2882453Domain d3slpb_: 3slp B: [185440]
    automated match to d1avqa_
    protein/DNA complex; complexed with ca, cl, po4

Details for d3slpb_

PDB Entry: 3slp (more details), 2.3 Å

PDB Description: Crystal Structure of Lambda Exonuclease in Complex with a 12 BP Symmetric DNA Duplex
PDB Compounds: (B:) Exonuclease

SCOPe Domain Sequences for d3slpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3slpb_ c.52.1.13 (B:) lambda exonuclease {Bacteriophage lambda [TaxId: 10710]}
mtpdiilqrtgidvraveqgddawhklrlgvitasevhnviakprsgkkwpdmkmsyfht
llaevctgvapevnakalawgkqyendartlfeftsgvnvtespiiyrdesmrtacspdg
lcsdgnglelkcpftsrdfmkfrlggfeaiksaymaqvqysmwvtrknawyfanydprmk
reglhyvvierdekymasfdeivpefiekmdealaeigfvfgeqwr

SCOPe Domain Coordinates for d3slpb_:

Click to download the PDB-style file with coordinates for d3slpb_.
(The format of our PDB-style files is described here.)

Timeline for d3slpb_: