Lineage for d3sjod_ (3sjo D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2797303Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2797308Protein 3C cysteine protease (picornain 3C) [50604] (9 species)
  7. 2797316Species Human enterovirus 71 [TaxId:39054] [189720] (3 PDB entries)
  8. 2797320Domain d3sjod_: 3sjo D: [185431]
    automated match to d1l1na_
    complexed with ag7

Details for d3sjod_

PDB Entry: 3sjo (more details), 1.7 Å

PDB Description: structure of EV71 3C in complex with Rupintrivir (AG7088)
PDB Compounds: (D:) 3C protease

SCOPe Domain Sequences for d3sjod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sjod_ b.47.1.4 (D:) 3C cysteine protease (picornain 3C) {Human enterovirus 71 [TaxId: 39054]}
ldfalsllrrnirqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnvldavelv
deqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvvqyg
flnlsgkpthrtmmynfptkagqcggvvtsvgkvigihiggngrqgfcaglkrsyfase

SCOPe Domain Coordinates for d3sjod_:

Click to download the PDB-style file with coordinates for d3sjod_.
(The format of our PDB-style files is described here.)

Timeline for d3sjod_: