Lineage for d1fqjb_ (1fqj B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 283641Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 283642Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) (S)
  5. 283643Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (7 proteins)
  6. 283666Protein RGS9, RGS domain [48101] (1 species)
  7. 283667Species Cow (Bos taurus) [TaxId:9913] [48102] (3 PDB entries)
  8. 283669Domain d1fqjb_: 1fqj B: [18543]
    Other proteins in same PDB: d1fqja1, d1fqja2, d1fqjc_, d1fqjd1, d1fqjd2

Details for d1fqjb_

PDB Entry: 1fqj (more details), 2.02 Å

PDB Description: crystal structure of the heterotrimeric complex of the rgs domain of rgs9, the gamma subunit of phosphodiesterase and the gt/i1 chimera alpha subunit [(rgs9)-(pdegamma)-(gt/i1alpha)-(gdp)-(alf4-)-(mg2+)]

SCOP Domain Sequences for d1fqjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqjb_ a.91.1.1 (B:) RGS9, RGS domain {Cow (Bos taurus)}
diptkmrverwafnfselirdpkgrqsfqhflrkefsgenlgfweacedlkygdqskvke
kaeeiyklflapgarrwinidgktmditvkglkhphryvldaaqthiymlmkkdsyaryl
kspiykemlakai

SCOP Domain Coordinates for d1fqjb_:

Click to download the PDB-style file with coordinates for d1fqjb_.
(The format of our PDB-style files is described here.)

Timeline for d1fqjb_: