Lineage for d3sj8a_ (3sj8 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2057861Protein 3C cysteine protease (picornain 3C) [50604] (9 species)
  7. 2057865Species Human coxsackievirus a16 [TaxId:31704] [189721] (3 PDB entries)
  8. 2057867Domain d3sj8a_: 3sj8 A: [185427]
    automated match to d1l1na_

Details for d3sj8a_

PDB Entry: 3sj8 (more details), 2.2 Å

PDB Description: Crystal structure of the 3C protease from coxsackievirus A16
PDB Compounds: (A:) 3C protease

SCOPe Domain Sequences for d3sj8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sj8a_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human coxsackievirus a16 [TaxId: 31704]}
ldfalsllrrnirqvqtdqghftmlgvrdrlailprhsqpgktiwvehklinvldavelv
deqgvnleltlvtldtnekfrdvtkfipetitgasdatliintehmpsmfvpvgdvvqyg
flnlsgkpthrtmmynfptkagqcggvvtsvgkiigihiggngrqgfcaglkrgyfase

SCOPe Domain Coordinates for d3sj8a_:

Click to download the PDB-style file with coordinates for d3sj8a_.
(The format of our PDB-style files is described here.)

Timeline for d3sj8a_: