Lineage for d1fqia_ (1fqi A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741165Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1741166Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1741167Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 1741210Protein RGS9, RGS domain [48101] (1 species)
  7. 1741211Species Cow (Bos taurus) [TaxId:9913] [48102] (3 PDB entries)
  8. 1741212Domain d1fqia_: 1fqi A: [18542]

Details for d1fqia_

PDB Entry: 1fqi (more details), 1.94 Å

PDB Description: rgs9 rgs domain
PDB Compounds: (A:) regulator of g-protein signaling 9

SCOPe Domain Sequences for d1fqia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fqia_ a.91.1.1 (A:) RGS9, RGS domain {Cow (Bos taurus) [TaxId: 9913]}
klvdiptkmrverwafnfselirdpkgrqsfqhflrkefsgenlgfweacedlkygdqsk
vkekaeeiyklflapgarrwinidgktmditvkglkhphryvldaaqthiymlmkkdsya
rylkspiykemlakaiep

SCOPe Domain Coordinates for d1fqia_:

Click to download the PDB-style file with coordinates for d1fqia_.
(The format of our PDB-style files is described here.)

Timeline for d1fqia_: