SCOPe 2.01: Domain d3sitb_: 3sit B:

Lineage for d3sitb_ (3sit B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)

6. Protein automated matches [190699] (2 species)
   not a true protein

7. Species Porcine rotavirus [TaxId:31578] [189719] (2 PDB entries)

8. Domain d3sitb_: 3sit B: [185419]
   automated match to d1kqra_
   complexed with mrd, na

Details for d3sitb_

PDB Entry: 3sit, 1.8 Å

PDB Description: crystal structure of porcine crw-8 rotavirus vp8* in complex with aceramido-gm3

PDB Compounds: (B:) Outer capsid protein VP4

SCOPe Domain Sequences for d3sitb_:

Sequence; same for both SEQRES and ATOM records:

>d3sitb_ b.29.1.14 (B:) automated matches {Porcine rotavirus [TaxId: 31578]}
lldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynlfg
qqvtlsventsqtqwkfidvskttptgnytqhgplfstpklyavmkfsgriytyngttpn
attgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl

Timeline for d3sitb_:

• d3sitb_ is new in SCOPe 2.01-stable
  
• d3sitb_ appears in SCOPe 2.02
  
• d3sitb_ appears in the current release, SCOPe 2.08