Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins) automatically mapped to Pfam PF00426 |
Protein automated matches [190699] (4 species) not a true protein |
Species Porcine rotavirus [TaxId:31578] [189719] (3 PDB entries) |
Domain d3sitb_: 3sit B: [185419] Other proteins in same PDB: d3sita2 automated match to d1kqra_ complexed with mrd, na |
PDB Entry: 3sit (more details), 1.8 Å
SCOPe Domain Sequences for d3sitb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3sitb_ b.29.1.14 (B:) automated matches {Porcine rotavirus [TaxId: 31578]} lldgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynlfg qqvtlsventsqtqwkfidvskttptgnytqhgplfstpklyavmkfsgriytyngttpn attgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl
Timeline for d3sitb_: