Lineage for d3sisb_ (3sis B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780402Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
    automatically mapped to Pfam PF00426
  6. 2780411Protein automated matches [190699] (4 species)
    not a true protein
  7. 2780415Species Porcine rotavirus [TaxId:31578] [189719] (3 PDB entries)
  8. 2780421Domain d3sisb_: 3sis B: [185417]
    Other proteins in same PDB: d3sisa2
    automated match to d1kqra_
    complexed with mn0, mpd, na

Details for d3sisb_

PDB Entry: 3sis (more details), 2.2 Å

PDB Description: crystal structure of porcine crw-8 rotavirus vp8* in complex with aceramido-gm3_gc
PDB Compounds: (B:) Outer capsid protein VP4

SCOPe Domain Sequences for d3sisb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sisb_ b.29.1.14 (B:) automated matches {Porcine rotavirus [TaxId: 31578]}
dgpyqpttfnpptsywillaptvegvviqgtnnidrwlatiliepnvqttnriynlfgqq
vtlsventsqtqwkfidvskttptgnytqhgplfstpklyavmkfsgriytyngttpnat
tgyysttnydtvnmtsfcdfyiiprnqeekcteyinhgl

SCOPe Domain Coordinates for d3sisb_:

Click to download the PDB-style file with coordinates for d3sisb_.
(The format of our PDB-style files is described here.)

Timeline for d3sisb_: