Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology missing some secondary structures that made up less than one-third of the common domain |
Protein Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain [102378] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [102379] (9 PDB entries) Uniprot P26361 390-670 |
Domain d3si7c1: 3si7 C:389-670 [185412] Other proteins in same PDB: d3si7c2 automated match to d1q3hc_ complexed with act, atp, mg; mutant |
PDB Entry: 3si7 (more details), 2.25 Å
SCOPe Domain Sequences for d3si7c1:
Sequence, based on SEQRES records: (download)
>d3si7c1 c.37.1.12 (C:389-670) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} ttgiimenvtafweegfgellekvqqsngdrkhssdennvsfshlclvgnpvlkninlni ekgemlaitgstgsgktsllmlilgeleasegiikhsgrvsfcsqfswimpgtikeniig vsydeyryksvvkacqlqqditkfaeqdntvlgeggvtlsggqrarislaravykdadly lldspfgyldvfteeqvfescvcklmanktrilvtskmehlrkadkililhqgssyfygt fselqslrpdfssklmgydtfdqfteerrssiltetlrrfs
>d3si7c1 c.37.1.12 (C:389-670) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} ttgiimenvtafweegfgellekvqshlclvgnpvlkninlniekgemlaitgstgsgkt sllmlilgeleasegiikhsgrvsfcsqfswimpgtikeniigvsydeyryksvvkacql qqditkfaeqdntvlgeggvtlsggqrarislaravykdadlylldspfgyldvfteeqv fescvcklmanktrilvtskmehlrkadkililhqgssyfygtfselqslrpdfssklmg ydtfdqfteerrssiltetlrrfs
Timeline for d3si7c1: