Lineage for d1ezta_ (1ezt A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004960Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2004961Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2004962Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 2004999Protein Regulator of G-protein signaling 4, RGS4 [48099] (1 species)
  7. 2005000Species Norway rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries)
  8. 2005003Domain d1ezta_: 1ezt A: [18541]

Details for d1ezta_

PDB Entry: 1ezt (more details)

PDB Description: high-resolution solution structure of free rgs4 by nmr
PDB Compounds: (A:) regulator of g-protein signaling 4

SCOPe Domain Sequences for d1ezta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezta_ a.91.1.1 (A:) Regulator of G-protein signaling 4, RGS4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
srfyldltn

SCOPe Domain Coordinates for d1ezta_:

Click to download the PDB-style file with coordinates for d1ezta_.
(The format of our PDB-style files is described here.)

Timeline for d1ezta_: