Lineage for d3si2a_ (3si2 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2126724Superfamily c.56.5: Zn-dependent exopeptidases [53187] (10 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 2127146Family c.56.5.8: Glutaminyl-peptide cyclotransferase-like [142532] (1 protein)
    part of Pfam PF04389
  6. 2127147Protein Glutaminyl-peptide cyclotransferase, QPCT [142533] (2 species)
    Glutaminyl cyclase
  7. 2127194Species Mouse (Mus musculus) [TaxId:10090] [189699] (2 PDB entries)
  8. 2127195Domain d3si2a_: 3si2 A: [185409]
    automated match to d2afma1
    complexed with act, pbd, so4, zn

Details for d3si2a_

PDB Entry: 3si2 (more details), 1.8 Å

PDB Description: structure of glycosylated murine glutaminyl cyclase in presence of the inhibitor pq50 (pdbd150)
PDB Compounds: (A:) Glutaminyl-peptide cyclotransferase

SCOPe Domain Sequences for d3si2a_:

Sequence, based on SEQRES records: (download)

>d3si2a_ c.56.5.8 (A:) Glutaminyl-peptide cyclotransferase, QPCT {Mouse (Mus musculus) [TaxId: 10090]}
awtqeknhhqpahlnssslqqvaegtsisemwqndlrpllierypgspgsysarqhimqr
iqrlqaewvvevdtflsrtpygyrsfsniistlnpeakrhlvlachydskyfprwdsrvf
vgatdsavpcammlelaraldkklhslkdvsgskpdlslqliffdgeeafhhwspqdsly
gsrhlaqkmassphppgsrgtnqldgmdllvlldligaanptfpnffpkttrwfnrlqai
ekelyelgllkdhslerkyfqnfgygniiqddhipflrkgvpvlhliaspfpevwhtmdd
neenlhastidnlnkiiqvfvleylhl

Sequence, based on observed residues (ATOM records): (download)

>d3si2a_ c.56.5.8 (A:) Glutaminyl-peptide cyclotransferase, QPCT {Mouse (Mus musculus) [TaxId: 10090]}
awtqeknhhqpahlnssslqqvaegtsisemwqndlrpllierypgspgsysarqhimqr
iqrlqaewvvevdtflsrtpygyrsfsniistlnpeakrhlvlachydskyfprwdsrvf
vgatdsavpcammlelaraldkklhslkdpdlslqliffdgeeafhhwspqdslygsrhl
aqkmassphppgsrgtnqldgmdllvlldligaanptfpnffpkttrwfnrlqaiekely
elgllkdhslerkyfqnfgygniiqddhipflrkgvpvlhliaspfpevwhtmddneenl
hastidnlnkiiqvfvleylhl

SCOPe Domain Coordinates for d3si2a_:

Click to download the PDB-style file with coordinates for d3si2a_.
(The format of our PDB-style files is described here.)

Timeline for d3si2a_: