Lineage for d1ezya_ (1ezy A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741165Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 1741166Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 1741167Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 1741204Protein Regulator of G-protein signaling 4, RGS4 [48099] (1 species)
  7. 1741205Species Norway rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries)
  8. 1741209Domain d1ezya_: 1ezy A: [18540]

Details for d1ezya_

PDB Entry: 1ezy (more details)

PDB Description: high-resolution solution structure of free rgs4 by nmr
PDB Compounds: (A:) regulator of g-protein signaling 4

SCOPe Domain Sequences for d1ezya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezya_ a.91.1.1 (A:) Regulator of G-protein signaling 4, RGS4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
srfyldltn

SCOPe Domain Coordinates for d1ezya_:

Click to download the PDB-style file with coordinates for d1ezya_.
(The format of our PDB-style files is described here.)

Timeline for d1ezya_: