Lineage for d1ezya_ (1ezy A:)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 215831Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 215832Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) (S)
  5. 215833Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (6 proteins)
  6. 215847Protein Regulator of G-protein signalling 4, RGS4 [48099] (1 species)
  7. 215848Species Rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries)
  8. 215851Domain d1ezya_: 1ezy A: [18540]

Details for d1ezya_

PDB Entry: 1ezy (more details)

PDB Description: high-resolution solution structure of free rgs4 by nmr

SCOP Domain Sequences for d1ezya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ezya_ a.91.1.1 (A:) Regulator of G-protein signalling 4, RGS4 {Rat (Rattus norvegicus)}
vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
srfyldltn

SCOP Domain Coordinates for d1ezya_:

Click to download the PDB-style file with coordinates for d1ezya_.
(The format of our PDB-style files is described here.)

Timeline for d1ezya_: