Lineage for d1ezya_ (1ezy A:)
- Root: SCOP 1.61
Class a: All alpha proteins [46456] (151 folds) 
Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily) Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) 
Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (6 proteins) 
Protein Regulator of G-protein signalling 4, RGS4 [48099] (1 species) Species Rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries) 
Domain d1ezya_: 1ezy A: [18540]
Details for d1ezya_
PDB Entry: 1ezy (more details)
PDB Description: high-resolution solution structure of free rgs4 by nmr
SCOP Domain Sequences for d1ezya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ezya_ a.91.1.1 (A:) Regulator of G-protein signalling 4, RGS4 {Rat (Rattus norvegicus)}
vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
srfyldltn
SCOP Domain Coordinates for d1ezya_:
Click to download the PDB-style file with coordinates for d1ezya_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ezya_:
- d1ezya_ first appeared (with stable ids) in SCOP 1.55
- d1ezya_ appears in SCOP 1.59
- d1ezya_ appears in SCOP 1.63
- d1ezya_ appears in the current release, SCOPe 2.08
View in 3D