Lineage for d1agre_ (1agr E:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004960Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2004961Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2004962Family a.91.1.1: Regulator of G-protein signaling, RGS [48098] (10 proteins)
  6. 2004999Protein Regulator of G-protein signaling 4, RGS4 [48099] (1 species)
  7. 2005000Species Norway rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries)
  8. 2005001Domain d1agre_: 1agr E: [18538]
    Other proteins in same PDB: d1agra1, d1agra2, d1agrd1, d1agrd2
    complexed with alf, cit, gdp, mg

Details for d1agre_

PDB Entry: 1agr (more details), 2.8 Å

PDB Description: complex of alf4-activated gi-alpha-1 with rgs4
PDB Compounds: (E:) rgs4

SCOPe Domain Sequences for d1agre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agre_ a.91.1.1 (E:) Regulator of G-protein signaling 4, RGS4 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
srfyldlt

SCOPe Domain Coordinates for d1agre_:

Click to download the PDB-style file with coordinates for d1agre_.
(The format of our PDB-style files is described here.)

Timeline for d1agre_: