SCOP 1.63: Domain d1agre_: 1agr E:

Lineage for d1agre_ (1agr E:)

1. Root: SCOP 1.63

2. Class a: All alpha proteins [46456] (171 folds)

3. Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family)

5. Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (6 proteins)

6. Protein Regulator of G-protein signalling 4, RGS4 [48099] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries)

8. Domain d1agre_: 1agr E: [18538]
   Other proteins in same PDB: d1agra1, d1agra2, d1agrd1, d1agrd2

Details for d1agre_

PDB Entry: 1agr, 2.8 Å

PDB Description: complex of alf4-activated gi-alpha-1 with rgs4

SCOP Domain Sequences for d1agre_:

Sequence; same for both SEQRES and ATOM records:

>d1agre_ a.91.1.1 (E:) Regulator of G-protein signalling 4, RGS4 {Rat (Rattus norvegicus)}
vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
srfyldlt

Timeline for d1agre_:

• d1agre_ first appeared (with stable ids) in SCOP 1.55
  
• d1agre_ appears in SCOP 1.61
  
• d1agre_ appears in SCOP 1.65
  
• d1agre_ appears in the current release, SCOPe 2.08