Lineage for d1agre_ (1agr E:)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 49601Fold a.91: Regulator of G-protein signalling, RGS [48096] (1 superfamily)
  4. 49602Superfamily a.91.1: Regulator of G-protein signalling, RGS [48097] (1 family) (S)
  5. 49603Family a.91.1.1: Regulator of G-protein signalling, RGS [48098] (6 proteins)
  6. 49617Protein Regulator of G-protein signalling 4, RGS4 [48099] (1 species)
  7. 49618Species Rat (Rattus norvegicus) [TaxId:10116] [48100] (3 PDB entries)
  8. 49619Domain d1agre_: 1agr E: [18538]
    Other proteins in same PDB: d1agra1, d1agra2, d1agrd1, d1agrd2

Details for d1agre_

PDB Entry: 1agr (more details), 2.8 Å

PDB Description: complex of alf4-activated gi-alpha-1 with rgs4

SCOP Domain Sequences for d1agre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agre_ a.91.1.1 (E:) Regulator of G-protein signalling 4, RGS4 {Rat (Rattus norvegicus)}
vsqeevkkwaeslenlinhecglaafkaflkseyseenidfwisceeykkikspsklspk
akkiynefisvqatkevnldsctreetsrnmleptitcfdeaqkkifnlmekdsyrrflk
srfyldlt

SCOP Domain Coordinates for d1agre_:

Click to download the PDB-style file with coordinates for d1agre_.
(The format of our PDB-style files is described here.)

Timeline for d1agre_: