Lineage for d3sh3a_ (3sh3 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778888Protein automated matches [190035] (28 species)
    not a true protein
  7. 2779045Species Dioclea wilsonii [TaxId:763456] [189735] (1 PDB entry)
  8. 2779046Domain d3sh3a_: 3sh3 A: [185374]
    automated match to d1dgla_
    complexed with a3b, ca, cl, mn, xmm

Details for d3sh3a_

PDB Entry: 3sh3 (more details), 2.3 Å

PDB Description: crystal structure of a pro-inflammatory lectin from the seeds of dioclea wilsonii standl
PDB Compounds: (A:) Lectin alpha chain

SCOPe Domain Sequences for d3sh3a_:

Sequence, based on SEQRES records: (download)

>d3sh3a_ b.29.1.1 (A:) automated matches {Dioclea wilsonii [TaxId: 763456]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi
adenslhfsfhkfsqnpkdlilqgdaftdsdgnleltkvsnsgdpqgnsvgralfyapvh
iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d3sh3a_ b.29.1.1 (A:) automated matches {Dioclea wilsonii [TaxId: 763456]}
adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr
lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktens
lhfsfhkfsqnpkdlilqgdaftdsdgnleltkvsnsgdpqgnsvgralfyapvhiweks
avvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan

SCOPe Domain Coordinates for d3sh3a_:

Click to download the PDB-style file with coordinates for d3sh3a_.
(The format of our PDB-style files is described here.)

Timeline for d3sh3a_: