![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein automated matches [190035] (28 species) not a true protein |
![]() | Species Dioclea wilsonii [TaxId:763456] [189735] (1 PDB entry) |
![]() | Domain d3sh3a_: 3sh3 A: [185374] automated match to d1dgla_ complexed with a3b, ca, cl, mn, xmm |
PDB Entry: 3sh3 (more details), 2.3 Å
SCOPe Domain Sequences for d3sh3a_:
Sequence, based on SEQRES records: (download)
>d3sh3a_ b.29.1.1 (A:) automated matches {Dioclea wilsonii [TaxId: 763456]} adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktnsi adenslhfsfhkfsqnpkdlilqgdaftdsdgnleltkvsnsgdpqgnsvgralfyapvh iweksavvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
>d3sh3a_ b.29.1.1 (A:) automated matches {Dioclea wilsonii [TaxId: 763456]} adtivaveldsypntdigdpnyphigidiksirskstarwnmqtgkvgtvhisynsvakr lsavvsysgsssttvsydvdlnnvlpewvrvglsattglyketntilswsftsklktens lhfsfhkfsqnpkdlilqgdaftdsdgnleltkvsnsgdpqgnsvgralfyapvhiweks avvasfdatftflikspdrepadgitffiantdtsipsgsggrllglfpdan
Timeline for d3sh3a_: