Lineage for d3sgha_ (3sgh A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1278585Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 1279354Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 1279560Family a.118.8.0: automated matches [191581] (1 protein)
    not a true family
  6. 1279561Protein automated matches [191037] (8 species)
    not a true protein
  7. 1279571Species Bacteroides thetaiotaomicron [TaxId:818] [189698] (1 PDB entry)
  8. 1279572Domain d3sgha_: 3sgh A: [185372]
    automated match to d3cgha1
    complexed with cl

Details for d3sgha_

PDB Entry: 3sgh (more details), 1.7 Å

PDB Description: crystal structure of a susd-like protein (bt_3752) from bacteroides thetaiotaomicron vpi-5482 at 1.70 a resolution
PDB Compounds: (A:) SusD homolog

SCOPe Domain Sequences for d3sgha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3sgha_ a.118.8.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
pasnllstmfnvyacpqqnacqeincmwasfsgqvtatanwsfgknifayynaseghnds
swgrlygyiypsfflvenstekkgviyamaqltrvygmqllaslqgpipytqmkagetea
pydneqtvwhamfddldnaitilksaatfgvnqdlavvdqfykgdcskwlkfantlklrm
airisgvepeyaqtkaqeavlggvmesvgdssydttngginengyaivsgwpevranacl
vsymngyndprrpayftpqtqtaaggyvgvrsgsaeipeptvyanysklfiatdktlpqp
vmyaaeaaflraegalkgwnmggdaktfyekgvrlsfeefgvsgaddyladatsipgnyv
dnliaghtgnnytnqssitikwedgaddakklervltqkwiacypdpmngwadfrrtgyp
rifpatesmnadcntgrgqrrlrftrseynnnkanveaavsmlsngkdsngtdlwwamke
ngty

SCOPe Domain Coordinates for d3sgha_:

Click to download the PDB-style file with coordinates for d3sgha_.
(The format of our PDB-style files is described here.)

Timeline for d3sgha_: